The domain within your query sequence starts at position 130 and ends at position 274; the E-value for the d1a4ya_ domain shown below is 4e-3.

SIQHLELDRLVWRNSIRGSLIKSLSFFLKKMGKHLDHLSLKGARLTVEQGCHILNSLSYM
QNENMASELNIEDFFSHHLAVYGSSQFNKAMATFRNLTFLTLNYNCISDELLETLSENNA
GTLRTMNIKCHVHDPHGQVVWGMSW

This is a SCOP domain - please see the SCOP entry of d1a4ya_ for further annotation