The domain within your query sequence starts at position 117 and ends at position 262; the E-value for the d1a9na_ domain shown below is 4e-16.

IKDTFFYSYFRSLRVVNKGVSLVDKDLLKFLKLEELVLSANKIEEIDANNLPPTLKVLEL
YGNLIASMECLCSAPPPRLQHLGLGHNKLLGPLESLYVTSHNWPQLVSLDLGFNNLTDLQ
NMILGLSTLRHLRLLVLQGNPLSLVP

This is a SCOP domain - please see the SCOP entry of d1a9na_ for further annotation