SMART: SCOP domain d1b8pa1

The domain within your query sequence starts at position 131 and ends at position 282; the E-value for the d1b8pa1 domain shown below is 1e-16.

PLQVWIASAGTYVCCHLIPLLLSGEVFGMHTEISLTLFDQEQREDCLRSIVMETQDLASP
VLRTVSFCTTVKEAFLQAQVIIILDDSTEEEVYSLESCLRSRVPLCRLYGYLIEKNAHKS
VKVIVGGKNFVNLKTTLLMQYAPNIASNIIAV

The domain within your query sequence starts at position 131 and ends at position 282; the E-value for the d1b8pa1 domain shown below is 1e-16.

This is a SCOP domain - please see the SCOP entry of d1b8pa1 for further annotation