SMART: SCOP domain d1bg1a1

The domain within your query sequence starts at position 289 and ends at position 458; the E-value for the d1bg1a1 domain shown below is 5e-4.

QQYEQKITELRQKLVDLQKQVTELEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEA
KELRQKVRYLQDQLSPLTRQREYQEKEIQRLNKALEEALSIQASPSSPPAAFGSPEGVGG
HLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQ

The domain within your query sequence starts at position 289 and ends at position 458; the E-value for the d1bg1a1 domain shown below is 5e-4.

This is a SCOP domain - please see the SCOP entry of d1bg1a1 for further annotation