SMART: SCOP domain d1d5ra2

The domain within your query sequence starts at position 118 and ends at position 274; the E-value for the d1d5ra2 domain shown below is 1e-20.

DLDFTYVTSRIIVMSFPVDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFH
SRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFC
NLYSTPGPAVRLLYAKRPGIGLSPSHRRYLGYMCDLL

The domain within your query sequence starts at position 118 and ends at position 274; the E-value for the d1d5ra2 domain shown below is 1e-20.

This is a SCOP domain - please see the SCOP entry of d1d5ra2 for further annotation