SMART: SCOP domain d1dgua

The domain within your query sequence starts at position 258 and ends at position 413; the E-value for the d1dgua_ domain shown below is 4e-8.

EELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSRYGTATMTNVFLDRVFQE
CLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGYLNVFSLNYFFRAIQELM
KIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLIN

The domain within your query sequence starts at position 258 and ends at position 413; the E-value for the d1dgua_ domain shown below is 4e-8.

This is a SCOP domain - please see the SCOP entry of d1dgua_ for further annotation