The domain within your query sequence starts at position 1066 and ends at position 1144; the E-value for the d1e69a_ domain shown below is 2e-7.

DGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQ
NIGQMLRTHFTHSQFIVVS

This is a SCOP domain - please see the SCOP entry of d1e69a_ for further annotation