SMART: SCOP domain d1eq1a

The domain within your query sequence starts at position 1632 and ends at position 1786; the E-value for the d1eq1a_ domain shown below is 5e-17.

DTQNTEQTLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSLAASTAEETAGS
AQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEARDLLQAAQDKLQ
RLQELEGTYEENERALEGKAAQLDGLEARMRSVLQ

The domain within your query sequence starts at position 1632 and ends at position 1786; the E-value for the d1eq1a_ domain shown below is 5e-17.

This is a SCOP domain - please see the SCOP entry of d1eq1a_ for further annotation