SMART: SCOP domain d1eucb1

The domain within your query sequence starts at position 255 and ends at position 417; the E-value for the d1eucb1 domain shown below is 1e-26.

DLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQ
QTYDYAKTILSLMTREKHPEGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVT
IFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGM

The domain within your query sequence starts at position 255 and ends at position 417; the E-value for the d1eucb1 domain shown below is 1e-26.

This is a SCOP domain - please see the SCOP entry of d1eucb1 for further annotation