SMART: SCOP domain d1eula

The domain within your query sequence starts at position 5 and ends at position 180; the E-value for the d1eula_ domain shown below is 9e-15.

WVLIFFNLLFTSVPPIIYGVLEKDVSAETLLQLPELYRSGQRSEEYLPLTFWITLLDAFY
QSLVCFFVPYFTYQGSDIDIFTFGNPLNTAALFIILLHLVIESKSLTWIHMLVTVGSILS
YFFFALAFGALCVTCNPPSNPYGIMRKHMLDPVFYLVCVLTTFVALLPRFLYRVLQ

The domain within your query sequence starts at position 5 and ends at position 180; the E-value for the d1eula_ domain shown below is 9e-15.

This is a SCOP domain - please see the SCOP entry of d1eula_ for further annotation