SMART: SCOP domain d1g2ia

The domain within your query sequence starts at position 54 and ends at position 206; the E-value for the d1g2ia_ domain shown below is 7e-9.

VDVTESNARWVQDFRLKAYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQH
FRSESKPICAIGHGVAALCCATNEDRSWVFQGYSLTGPSVYELIRAPGFARLPLIVEDFV
KDSGAGFSASEPDAVHVVLDRHLVTGQNANSTV

The domain within your query sequence starts at position 54 and ends at position 206; the E-value for the d1g2ia_ domain shown below is 7e-9.

This is a SCOP domain - please see the SCOP entry of d1g2ia_ for further annotation