SMART: SCOP domain d1hdr_

The domain within your query sequence starts at position 6 and ends at position 159; the E-value for the d1hdr__ domain shown below is 6e-16.

EARRVLVYGGRGALGSRCVQAFRARNWERPREGSASCVLCLPILKSSGGSLRKPEKQKVT
ADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKE
GGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQ

The domain within your query sequence starts at position 6 and ends at position 159; the E-value for the d1hdr__ domain shown below is 6e-16.

This is a SCOP domain - please see the SCOP entry of d1hdr__ for further annotation