SMART: SCOP domain d1jfza

The domain within your query sequence starts at position 72 and ends at position 224; the E-value for the d1jfza_ domain shown below is 5e-23.

VQAFGSRLQETFSLDLLKTAFINSCYIKSEEAKRQSLGIEKEAALLNLKDNQELFEQGLS
FSHRCLTQFLEDEFPDLPAEGTESLVSFLTGEAVVCHVARNLAVEQLTLSAEFPVPLPVL
RQTFFAVIGALLQSSGPERAALFIRDFLITQMT

The domain within your query sequence starts at position 72 and ends at position 224; the E-value for the d1jfza_ domain shown below is 5e-23.

This is a SCOP domain - please see the SCOP entry of d1jfza_ for further annotation