SMART: SCOP domain d1kjwa2

The domain within your query sequence starts at position 975 and ends at position 1154; the E-value for the d1kjwa2 domain shown below is 1e-16.

HCERRRPVLFTPTMLAKTLVQKLLNSGGAMEFTICKSDIVTRDEFLRKQKTETIIYSREK
NPNTFECIVPANIEAVAAKNKHCLLEAGIGCVRDLIKCKVYPIVLLIRVSEKNIKRFRKL
LPRPETEEEFLRVCRLKEKELEALPCLYATVEAEMWSSVEELLRVLKDKIVEEQRKTIWV

The domain within your query sequence starts at position 975 and ends at position 1154; the E-value for the d1kjwa2 domain shown below is 1e-16.

This is a SCOP domain - please see the SCOP entry of d1kjwa2 for further annotation