SMART: SCOP domain d1ld8a

The domain within your query sequence starts at position 105 and ends at position 272; the E-value for the d1ld8a_ domain shown below is 1e-7.

EQLHVSAVEMFAKGNFPRACDLWEQILRDHPTDMLALKFSHDAYFYLGYQEQMRDSVARV
YPFWTPDIPLNSYVKGIYSFGLMETNFYDQAQKLAKEALSIEPTDAWSVHTVAHVHEMRA
EIKDGLEFMQQSEGHWKDSDMLACHNYWHWALYLIEKGDYEAALTIYD

The domain within your query sequence starts at position 105 and ends at position 272; the E-value for the d1ld8a_ domain shown below is 1e-7.

This is a SCOP domain - please see the SCOP entry of d1ld8a_ for further annotation