SMART: SCOP domain d1pme_

The domain within your query sequence starts at position 308 and ends at position 457; the E-value for the d1pme__ domain shown below is 8e-8.

YKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLV
FAYDFHAGGETMMSRHFNDPNSDAYFTKRKWGQHDGPLPRQHAGLLPESLIWAYIVQLSS
ALRTIHTAGLACRVMDPTKILITSKTRLRV

The domain within your query sequence starts at position 308 and ends at position 457; the E-value for the d1pme__ domain shown below is 8e-8.

This is a SCOP domain - please see the SCOP entry of d1pme__ for further annotation