SMART: SCOP domain d1yrga

The domain within your query sequence starts at position 126 and ends at position 305; the E-value for the d1yrga_ domain shown below is 1e-7.

QKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVVAEKLEEIKSFRELTRLDLSCCWL
GDEHELLEHLTNEALSSVTQLHLKDNCLSDAGIRKMTAPVRVMKRGLENLALLDLSCNPE
ITDAGIGYLFSFRKLNCLDISGTGLKDIKAVKDKLRANIGLVHSKVPLKEFDHSNCKTEG

The domain within your query sequence starts at position 126 and ends at position 305; the E-value for the d1yrga_ domain shown below is 1e-7.

This is a SCOP domain - please see the SCOP entry of d1yrga_ for further annotation