The domain within your query sequence starts at position 588 and ends at position 738; the E-value for the d2bbkh_ domain shown below is 3e-8.

NSIVIWNLKTGQLLKKMHIDDSYQASVCHGAYSEKGLLFVVVSQPCAKESQALGSPVFQL
LVINPKTAQSVGVLLCSLPQGQAGRFLEGDVKDHVAAAVLTSGTIAIWDLLLGHCTALLP
PVSDQSWSLVKWSGTDSHLLAGQKDGNIFIY

This is a SCOP domain - please see the SCOP entry of d2bbkh_ for further annotation