The domain within your query sequence starts at position 13 and ends at position 228; the E-value for the SERPIN domain shown below is 3.54e-34.

LNLLKILGEDSSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALALDKCSGNGGGDVHQ
GFQSLLTEVNKTGTQYLLRTANRLFGDKTCDLLASFKDSCLKFYEAELEELDFQGATEES
RQHINTWVAKKTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFNKEHTREMPFKVS
KNEEKPVQMMFKKSTFKMTYIGEIFTKILLLPYVSS

SERPIN

SERine Proteinase INhibitors
SERPIN
SMART accession number:SM00093
Description: -
Interpro abstract (IPR023796):

Serpins (SERine Proteinase INhibitors) belong to MEROPS inhibitor family I4, clan ID. Most serpin family members are indeed serine protease inhibitors, but several have additional cross-class inhibition functions and inhibit cysteine protease family members such as the caspases and cathepsins [(PUBMED:8034697), (PUBMED:7851535)]. Others, such as ovalbumin, are incapable of protease inhibition and serve other functions [(PUBMED:8417965)].

Serpins share a highly conserved core structure that is critical for their functioning as serine protease inhibitors [(PUBMED:21781239)]. Inhibitory serpins comprise several alpha-helix and beta-strands together with an external reactive centre loop (RCL) containing the active site recognised by the target enzyme. Serpins form covalent complexes with target proteases. Their mechanism of protease inhibition is known as irreversible "trapping" in which a rapid conformational change traps the cognate protease in a covalent complex.

This entry represents the structural domain of serpins.
Family alignment:
View or

There are 21666 SERPIN domains in 21322 proteins in SMART's nrdb database.

Click on the following links for more information.