The domain within your query sequence starts at position 3 and ends at position 53; the E-value for the SFM domain shown below is 1.7e-26.

LSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKA

SFM

Splicing Factor Motif, present in Prp18 and Pr04
SFM
SMART accession number:SM00500
Description: -
Interpro abstract (IPR014906):

This small domain is found on PRP4 ribonuleoproteins. PRP4 is a U4/U6 small nuclear ribonucleoprotein that is involved in pre-mRNA processing [ (PUBMED:528687) ]. It is also found in pre-mRNA-splicing factor 18 [ (PUBMED:9000057) ].

Family alignment:
View or

There are 1137 SFM domains in 1133 proteins in SMART's nrdb database.

Click on the following links for more information.