The domain within your query sequence starts at position 1 and ends at position 193; the E-value for the SF_P domain shown below is 7.3e-150.

MDMSSKEVLMESPPDYSAGPRSQFRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHM
SQKHTEMVLEMSIGAPETQKRLAPSERADTIATFSIGSTGIVVYDYQRLLTAYKPAPGTY
CYIMKMAPESIPSLEAFARKLQNFQAKPSTPTSKLGQEEGHDTGSESDSSGRDLAFLGLA
VSTLCGELPLYYI

SF_P

Pulmonary surfactant proteins

• SMART accession number: SM00019
• Description: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines
• Interpro abstract (IPR001729):

  Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines [ (PUBMED:2326260) (PUBMED:2015882) ].

• GO process: respiratory gaseous exchange by respiratory system (GO:0007585)
• GO component: extracellular region (GO:0005576)

There are 68 SF_P domains in 68 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Hayami T et al.
• Specific loss of chondromodulin-I gene expression in chondrosarcoma and the suppression of tumor angiogenesis and growth by its recombinant protein in vivo.
• FEBS Lett. 1999; 458: 436-40

Chondromodulin-I (ChM-I) was previously identified as an angiogenesis inhibitor in cartilage. Here, we demonstrated that the level of ChM-I transcripts was substantially reduced to 100 or even less in the lower-grade chondrosarcomas, in articular cartilage or other benign cartilage tumors. We implanted human chondrosarcoma OUMS-27 cells into nude mice that reproducibly produced tumors with cartilaginous matrix. Tumor-induced angiogenesis was evident when the tumors were excised 30 days after implantation. However, the local administration of recombinant human ChM-I almost completely blocked vascular invasion and tumor growth in vivo. Moreover, ChM-I also inhibited the growth of HT-29 colon adenocarcinoma in vivo, implying its therapeutic potential for solid tumors.

Disease (disease genes where sequence variants are found in this domain)

SwissProt sequences and OMIM curated human diseases associated with missense mutations within the SF_P domain.

Protein	Disease
Pulmonary surfactant-associated protein C (P11686) (SMART)	OMIM:178620: Pneumonitis, desquamative interstitial OMIM:263000:

Structure (3D structures containing this domain)

3D Structures of SF_P domains in PDB

PDB code	Title
2yad	BRICHOS domain of Surfactant protein C precursor protein

Links (links to other resources describing this domain)

• INTERPRO: IPR001729