The domain within your query sequence starts at position 43 and ends at position 187; the E-value for the SMI1_KNR4 domain shown below is 1.04e-3.

PAERHMISSWEQKNNCVMPEDVRNFYLMTNGFHMTWSVKLDEHIIPLGSMVINGISKLTQ
LIQSSVYSLPNAPTLADLEDDTQEGNEDHQLEKPHFDCRSAIFELDSCNGNGKVCLVYKN
GKPGLAHDTEIWFLDRALYWHFLTD

SMI1_KNR4

SMI1 / KNR4 family
SMI1_KNR4
SMART accession number:SM00860
Description: Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation.
Interpro abstract (IPR018958):

This domain is found in the yeast cell wall assembly regulator Smi1 (also known as Knr4) [(PUBMED:7937796), (PUBMED:8289782)].

Saccharomyces cerevisiae Knr4 has a regulatory role in chitin deposition and in cell wall assembly [(PUBMED:10206705)]. It is believed to connect the PKC1-SLT2 MAPK pathway with cell proliferation. It has been shown to interact with Bck2, a gene involved in cell cycle progression in S. cerevisiae (forming a complex) to allow PKC1 to coordinate the cell cycle (cell proliferation) with cell wall integrity [(PUBMED:12185498), (PUBMED:12823808)]. Knr4 also interacts with the tyrosine-tRNA synthetase protein encoded by Tys1 and is involved in sporulation process [(PUBMED:11410349)].

Proteins containing this domain also include the animal F-box only protein 3 (FBXO3). In humans, FBXO3 is a substrate recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex [(PUBMED:18809579)].

Interestingly, Smi1/Knr4 homologues from bacteria are potential immunity proteins in a subset of these contact-dependent inhibitory toxin systems [(PUBMED:21306995)].

Note: previously reported evidence that Knr4 may interact with nuclear matrix-association region [(PUBMED:8516310)] may be due to an artefact [(PUBMED:10206705)].

Family alignment:
View or

There are 15672 SMI1_KNR4 domains in 15452 proteins in SMART's nrdb database.

Click on the following links for more information.