The domain within your query sequence starts at position 513 and ends at position 549; the E-value for the SOCS_box domain shown below is 7.37e-9.

VKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKF

SOCS_box

SOCS_box
SMART accession number:SM00969
Description: The SOCS box acts as a bridge between specific substrate- binding domains and more generic proteins that comprise a large family of E3 ubiquitin protein ligases.
Family alignment:
View or

There are 14201 SOCS_box domains in 14182 proteins in SMART's nrdb database.

Click on the following links for more information.