The domain within your query sequence starts at position 407 and ends at position 532; the E-value for the SPRY domain shown below is 3.25e-28.

TGCHYWEVYVGEKTKWILGVCSESVSRKGKVTASPANGHWLVRQSRGNEYEALTSPQTSF
RLKESPKCVGIFLDYEAGIISFYNVTDKSHIFTFTHSFSSPLRPFFEPCLHDEGKNTAPL
IICTEL

SPRY

Domain in SPla and the RYanodine Receptor.
SPRY
SMART accession number:SM00449
Description: Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues.
Interpro abstract (IPR003877): The SPRY domain is named from SPla and the RYanodine Receptor. Its function is unknown. Distant homologues are domains in butyrophilin/marenostrin/pyrin [(PUBMED:9204703)]. Ca2+-release from the sarcoplasmic or endoplasmic reticulum, the intracellular Ca2+ store, is mediated by the ryanodine receptor (RyR) and/or the inositol trisphosphate receptor (IP3R).
GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 24471 SPRY domains in 20651 proteins in SMART's nrdb database.

Click on the following links for more information.