The domain within your query sequence starts at position 573 and ends at position 680; the E-value for the SPT2 domain shown below is 1.3e-32.

RLPFPTGYKRPREYEEDDDDEYDSEMDDFIEDEGEPQEEISKHIREIFGYDRKKYKDESD
YALRYMESSWKEQQKEEAKSLRLGMQEDLEEMRREEEELKRRKAKKLK

SPT2

SPT2 chromatin protein
SPT2
SMART accession number:SM00784
Description: This entry includes the Saccharomyces cerevisiae protein SPT2 which is a chromatin protein involved in transcriptional regulation (PUBMED:15563464).
Interpro abstract (IPR013256):

This entry includes the Saccharomyces cerevisiae (Baker's yeast) protein SPT2 which is a chromatin protein involved in transcriptional regulation [ (PUBMED:15563464) ].

These proteins shows conservation of several domains across numerous species, including having a cluster of positively charged amino acids. This cluster probably functions in the binding properties of the proteins [ (PUBMED:15563464) ]. Sin1p/Spt2p probably modulates the local chromatin structure by binding two strands of double-stranded DNA at their crossover point.

Sin1p/Spt2p has sequence similarity to HMG1 and serves as a negative transcriptional regulator of a small family of genes that are activated by the SWI/SNF chromatin-remodelling complex. It is also involved in maintaining the integrity of chromatin during transcription elongation. Sin1p/Spt2 is required for, and is directly involved in, the efficient recruitment of the mRNA cleavage/polyadenylation complex [ (PUBMED:16788068) ]. Spt2 is also involved in regulating levels of histone H3 over transcribed regions [ (PUBMED:16449659) ].

Family alignment:
View or

There are 1333 SPT2 domains in 1333 proteins in SMART's nrdb database.

Click on the following links for more information.