The domain within your query sequence starts at position 768 and ends at position 822; the E-value for the SWAP domain shown below is 1.12e-14.

METAEKLARFVAQVGPEIEQFSIENSTDNPDLWFLHDQSSSAFKFYREKVLELCP

SWAP

Suppressor-of-White-APricot splicing regulator
SWAP
SMART accession number:SM00648
Description: domain present in regulators which are responsible for pre-mRNA splicing processes
Interpro abstract (IPR000061):

SWAP is derived from the Suppressor-of-White-APricot splicing regulator from Drosophila melanogaster. The domain is found in regulators responsible for pervasive, nonsex-specific alternative pre-mRNA splicing characteristics and has been found in splicing regulatory proteins [(PUBMED:8206918)]. These ancient, conserved SWAP proteins share a colinearly arrayed series of novel sequence motifs [(PUBMED:7971282)].

GO process:RNA processing (GO:0006396)
GO function:RNA binding (GO:0003723)
Family alignment:
View or

There are 9632 SWAP domains in 6348 proteins in SMART's nrdb database.

Click on the following links for more information.