The domain within your query sequence starts at position 291 and ends at position 370; the E-value for the SWIB domain shown below is 1.97e-35.

QPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVLCDKYLQQIFESQ
RMKFSEIPQRLHALLMPPEP

SWIB

SWI complex, BAF60b domains
SWIB
SMART accession number:SM00151
Description: -
Interpro abstract (IPR019835):

The SWI/SNF family of complexes, which are conserved from yeast to humans, are ATP-dependent chromatin-remodelling proteins that facilitate transcription activation [ (PUBMED:11147808) ]. The mammalian complexes are made up of 9-12 proteins called BAFs (BRG1-associated factors). The BAF60 family have at least three members: BAF60a, which is ubiquitous, BAF60b and BAF60c, which are expressed in muscle and pancreatic tissues, respectively. BAF60b is present in alternative forms of the SWI/SNF complex, including complex B (SWIB), which lacks BAF60a. The SWIB domain is a conserved region found within the BAF60b proteins [ (PUBMED:12016060) ], and can be found fused to the C terminus of DNA topoisomerase in Chlamydia.

Family alignment:
View or

There are 5075 SWIB domains in 4496 proteins in SMART's nrdb database.

Click on the following links for more information.