The domain within your query sequence starts at position 30 and ends at position 121; the E-value for the Sec3-PIP2_bind domain shown below is 5.63e-11.
SVQDRYFLCVSVTKTDEVKITMVKHYRVGLDEKYEVTKRWSLSDLRMIDGKEADTDNPFF DLHFKKVYSLEAYSCASKYSFARTVSRLNHVY
Sec3-PIP2_bindExocyst complex component SEC3 N-terminal PIP2 binding PH |
---|
SMART accession number: | SM01313 |
---|---|
Description: | This is the N-terminal domain of fungal and eukaryotic Sec3 proteins. Sec3 is a component of the exocyst complex that is involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.This N-terminal domain contains a cryptic pleckstrin homology (PH) fold, and all six positively charged lysine and arginine residues in the PH domain predicted to bind the PIP2 head group are conserved. The exocyst complex is essential for many exocytic events, by tethering vesicles at the plasma membrane for fusion. In fission yeast, polarised exocytosis for growth relies on the combined action of the exocyst at cell poles and myosin-driven transport along actin cables PMID:22768263. |
Interpro abstract (IPR028258): | This is the N-terminal domain of fungal and eukaryotic Sec3 proteins. Sec3 is a component of the exocyst complex that is involved in the targeting and tethering of post-Golgi secretory vesicles to fusion sites on the plasma membrane prior to SNARE-mediated fusion. This N-terminal domain contains a cryptic pleckstrin homology (PH) fold, and all six positively charged lysine and arginine residues in the PH domain predicted to bind the phosphatidylinositol 4,5-bisphosphate (PIP2) head group are conserved. In fission yeast, polarised exocytosis for growth relies on the combined action of the exocyst at cell poles and myosin-driven transport along actin cables [ (PUBMED:22768263) ]. |
Family alignment: |
There are 2190 Sec3-PIP2_bind domains in 2188 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)