The domain within your query sequence starts at position 44 and ends at position 213; the E-value for the SprT domain shown below is 4.39e-72.

PDLQALFLQFNDRFFWGQLEAVEVKWSVRMTLCAGICTYEGRGGMCSIRLSEPLLKLRPR
KDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINQLTGANITVYHTFHDEVDEY
RRHWWRCNGPCQHRQPYYGYVKRATNRAPSVHDYWWADHQKTCGGTYIKI

SprT

SprT homologues.
SprT
SMART accession number:SM00731
Description: Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Interpro abstract (IPR006640):

This entry represents a domain found in SprT (P39902), which is a regulator of bolA gene in stationary phase [(PUBMED:13129938)]. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases.

Family alignment:
View or

There are 7302 SprT domains in 7300 proteins in SMART's nrdb database.

Click on the following links for more information.