The domain within your query sequence starts at position 670 and ends at position 832; the E-value for the TLDc domain shown below is 1.05e-80.

SELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSD
GQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGG
EFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE

TLDc

domain in TBC and LysM domain containing proteins
TLDc
SMART accession number:SM00584
Description: -
Interpro abstract (IPR006571):

TLDc is a domain of unknown function, restricted to eukaryotes, and commonly found in TBC (IPR000195) and LysM domain containing proteins [(PUBMED:11779830)].

Family alignment:
View or

There are 7015 TLDc domains in 7012 proteins in SMART's nrdb database.

Click on the following links for more information.