The domain within your query sequence starts at position 121 and ends at position 162; the E-value for the TNFR domain shown below is 2.49e-5.

CIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVC

TNFR

Tumor necrosis factor receptor / nerve growth factor receptor repeats.
TNFR
SMART accession number:SM00208
Description: Repeats in growth factor receptors that are involved in growth factor binding. TNF/TNFR
Interpro abstract (IPR001368):

A number of proteins, some of which are known to be receptors for growth factors, have been found to contain a cysteine-rich domain of about 110 to 160 amino acids in their N-terminal part, that can be subdivided into four (or in some cases, three) modules of about 40 residues containing 6 conserved cysteines. Some of the proteins containing this domain are listed below [ (PUBMED:2174582) (PUBMED:15335933) (PUBMED:15335677) ]:

  • Tumor Necrosis Factor type I and type II receptors (TNFR). Both receptors bind TNF-alpha and TNF-beta, but are only similar in the cysteine-rich region. TNFR contains four cysteine-rich domain modules (CRDs), termed CRD1 through CRD4. CRD2 and CRD3 are known as TNF-binding domains [ (PUBMED:8387891) ].
  • Shope fibroma virus soluble TNF receptor (protein T2)
  • Lymphotoxin alpha/beta receptor
  • Low-affinity nerve growth factor receptor (LA-NGFR) (p75)
  • CD40 (Bp50), the receptor for the CD40L (or TRAP) cytokine
  • CD27, the receptor for the CD27L cytokine
  • CD30, the receptor for the CD30L cytokine
  • T-cell protein 4-1BB, the receptor for the 4-1BBL putative cytokine
  • FAS antigen (or APO-1), the receptor for FASL, a protein involved in apoptosis (programmed cell death)
  • T-cell antigen OX40, the receptor for the OX40L cytokine
  • Wsl-1, a receptor (for a yet undefined ligand) that mediates apoptosis
  • Vaccinia virus protein A53 (SalF19R)

It has been shown [ (PUBMED:8387891) ] that the six cysteines all involved in intrachain disulphide bonds. A schematic representation of the structure of the 40 residue module of these receptors is shown below:


+-------------+ +--------------+
| | | |
xCxxxxxxxxxxxxxCxCxxCxxxxxxxxxCxxxxCxx
| |
+------------+
'C': conserved cysteine involved in a disulphide bond.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 32859 TNFR domains in 11619 proteins in SMART's nrdb database.

Click on the following links for more information.