The domain within your query sequence starts at position 190 and ends at position 228; the E-value for the TRASH domain shown below is 1.77e0.

STKCSMCQKNAVIRHEVNYQNVVHKLCSDACFSKFRSAN

TRASH

metallochaperone-like domain
TRASH
SMART accession number:SM00746
Description: -
Interpro abstract (IPR011017):

TRASH domain contains a well-conserved cysteine motif that may be involved in metal coordination. TRASH is encoded by multiple prokaryotic genomes and is present in transcriptional regulators, cation-transporting ATPases and hydrogenases, and is also present as a stand-alone module. The observed domain associations and conserved genome context of TRASH-encoding genes in prokaryotic genomes suggest that TRASH constitutes a novel component in metal trafficking and heavy-metal resistance. The precise role of the multiple copies of TRASH that are present in vertebrate proteins remains to be elucidated [(PUBMED:12713899)].

Family alignment:
View or

There are 24136 TRASH domains in 7020 proteins in SMART's nrdb database.

Click on the following links for more information.