The domain within your query sequence starts at position 3 and ends at position 117; the E-value for the TR_THY domain shown below is 3.05e-6.

TESSPLTTHVLDTASGLPAQGLCLRLSRLEAPCQQWMELRTSYTNLDGRCPGLLTPSQIK
PGTYKLFFDTERYWKERGQESFYPYVEVVFTITKETQKFHVPLLLSPWSYTTYRG

TR_THY

Transthyretin
TR_THY
SMART accession number:SM00095
Description: -
Interpro abstract (IPR023416):

This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain. However, most of the sequences listed in this family do not bind thyroid hormones. They are actually enzymes of the purine catabolism that catalyse the conversion of 5-hydroxyisourate (HIU) to OHCU [ (PUBMED:16098976) (PUBMED:16462750) ]. HIU hydrolysis is the original function of the family and is conserved from bacteria to mammals; transthyretins arose by gene duplications in the vertebrate lineage [ (PUBMED:16952372) (PUBMED:8428915) ]. HIUases are distinguished in the alignment from the conserved C-terminal YRGS sequence.

Transthyretin (formerly prealbumin) is one of 3 thyroid hormone-binding proteins found in the blood of vertebrates [ (PUBMED:1833190) ]. It is produced in the liver and circulates in the bloodstream, where it binds retinol and thyroxine (T4) [ (PUBMED:4054629) ]. It differs from the other 2 hormone-binding proteins (T4-binding globulin and albumin) in 3 distinct ways: (1) the gene is expressed at a high rate in the brain choroid plexus; (2) it is enriched in cerebrospinal fluid; and (3) no genetically caused absence has been observed, suggesting an essential role in brain function, distinct from that played in the bloodstream [ (PUBMED:1833190) ]. The protein consists of around 130 amino acids, which assemble as a homotetramer that contains an internal channel in which T4 is bound. Within this complex, T4 appears to be transported across the blood-brain barrier, where, in the choroid plexus, the hormone stimulates further synthesis of transthyretin. The protein then diffuses back into the bloodstream, where it binds T4 for transport back to the brain [ (PUBMED:1833190) ].

Family alignment:
View or

There are 3116 TR_THY domains in 3113 proteins in SMART's nrdb database.

Click on the following links for more information.