The domain within your query sequence starts at position 3 and ends at position 117; the E-value for the TR_THY domain shown below is 3.05e-6.
TESSPLTTHVLDTASGLPAQGLCLRLSRLEAPCQQWMELRTSYTNLDGRCPGLLTPSQIK PGTYKLFFDTERYWKERGQESFYPYVEVVFTITKETQKFHVPLLLSPWSYTTYRG
TR_THYTransthyretin |
---|
SMART accession number: | SM00095 |
---|---|
Description: | - |
Interpro abstract (IPR023416): | This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain. However, most of the sequences listed in this family do not bind thyroid hormones. They are actually enzymes of the purine catabolism that catalyse the conversion of 5-hydroxyisourate (HIU) to OHCU [ (PUBMED:16098976) (PUBMED:16462750) ]. HIU hydrolysis is the original function of the family and is conserved from bacteria to mammals; transthyretins arose by gene duplications in the vertebrate lineage [ (PUBMED:16952372) (PUBMED:8428915) ]. HIUases are distinguished in the alignment from the conserved C-terminal YRGS sequence. Transthyretin (formerly prealbumin) is one of 3 thyroid hormone-binding proteins found in the blood of vertebrates [ (PUBMED:1833190) ]. It is produced in the liver and circulates in the bloodstream, where it binds retinol and thyroxine (T4) [ (PUBMED:4054629) ]. It differs from the other 2 hormone-binding proteins (T4-binding globulin and albumin) in 3 distinct ways: (1) the gene is expressed at a high rate in the brain choroid plexus; (2) it is enriched in cerebrospinal fluid; and (3) no genetically caused absence has been observed, suggesting an essential role in brain function, distinct from that played in the bloodstream [ (PUBMED:1833190) ]. The protein consists of around 130 amino acids, which assemble as a homotetramer that contains an internal channel in which T4 is bound. Within this complex, T4 appears to be transported across the blood-brain barrier, where, in the choroid plexus, the hormone stimulates further synthesis of transthyretin. The protein then diffuses back into the bloodstream, where it binds T4 for transport back to the brain [ (PUBMED:1833190) ]. |
Family alignment: |
There are 3116 TR_THY domains in 3113 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing TR_THY domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with TR_THY domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing TR_THY domain in the selected taxonomic class.
- Disease (disease genes where sequence variants are found in this domain)
-
SwissProt sequences and OMIM curated human diseases associated with missense mutations within the TR_THY domain.
Protein Disease Transthyretin (P02766) (SMART) OMIM:176300: Amyloid neuropathy, familial, several allelic types ; [Dystransthyretinemic hyperthyroxinemia]; Amyloidosis, senile systemic ; Carpal tunnel syndrome, familial - Metabolism (metabolic pathways involving proteins which contain this domain)
-
% proteins involved KEGG pathway ID Description 16.67 map05218 Melanoma 16.67 map05219 Bladder cancer 16.67 map04520 Adherens junction 16.67 map05216 Thyroid cancer 16.67 map05213 Endometrial cancer 16.67 map04514 Cell adhesion molecules (CAMs) This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with TR_THY domain which could be assigned to a KEGG orthologous group, and not all proteins containing TR_THY domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of TR_THY domains in PDB
PDB code Main view Title 1bm7 HUMAN TRANSTHYRETIN (PREALBUMIN) COMPLEX WITH FLUFENAMIC ACID (2-[[3-(TRIFLUOROMETHYL)PHENYL]AMINO] BENZOIC ACID) 1bmz HUMAN TRANSTHYRETIN (PREALBUMIN) 1bz8 TRANSTHYRETIN (DEL VAL122) 1bzd TERTIARY STRUCTURES OF THREE AMYLOIDOGENIC TRANSTHYRETIN VARIANTS AND IMPLICATIONS FOR AMYLOID FIBRIL FORMATION 1bze TERTIARY STRUCTURES OF THREE AMYLOIDOGENIC TRANSTHYRETIN VARIANTS AND IMPLICATIONS FOR AMYLOID FIBRIL FORMATION 1dvq CRYSTAL STRUCTURE OF HUMAN TRANSTHYRETIN 1dvs CRYSTAL STRUCTURE OF HUMAN TRANSTHYRETIN IN COMPLEX WITH RESVERATROL 1dvt CRYSTAL STRUCTURE OF HUMAN TRANSTHYRETIN IN COMPLEX WITH FLURBIPROFEN 1dvu CRYSTAL STRUCTURE OF HUMAN TRANSTHYRETIN IN COMPLEX WITH DIBENZOFURAN-4,6-DICARBOXYLIC ACID 1dvx CRYSTAL STRUCTURE OF HUMAN TRANSTHYRETIN IN COMPLEX WITH DICLOFENAC 1dvy CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH N-(M-TRIFLUOROMETHYLPHENYL) PHENOXAZINE-4,6-DICARBOXYLIC ACID 1dvz CRYSTAL STRUCTURE OF HUMAN TRANSTHYRETIN IN COMPLEX WITH O-TRIFLUOROMETHYLPHENYL ANTHRANILIC ACID 1e3f Structure of human transthyretin complexed with bromophenols: a new mode of binding 1e4h Structure of human transthyretin complexed with bromophenols: a new mode of binding 1e5a Structure of human transthyretin complexed with bromophenols: a new mode of binding 1eta THE X-RAY CRYSTAL STRUCTURE REFINEMENTS OF NORMAL HUMAN TRANSTHYRETIN AND THE AMYLOIDOGENIC VAL 30-->MET VARIANT TO 1.7 ANGSTROMS RESOLUTION 1etb THE X-RAY CRYSTAL STRUCTURE REFINEMENTS OF NORMAL HUMAN TRANSTHYRETIN AND THE AMYLOIDOGENIC VAL 30-->MET VARIANT TO 1.7 ANGSTROMS RESOLUTION 1f41 CRYSTAL STRUCTURE OF HUMAN TRANSTHYRETIN AT 1.5A RESOLUTION 1f86 TRANSTHYRETIN THR119MET PROTEIN STABILISATION 1fh2 TRANSTHYRETIN STABILITY AS A KEY FACTOR IN AMYLOIDOGENESIS 1fhn TRANSTHYRETIN STABILITY AS A KEY FACTOR IN AMYLOIDOGENESIS 1g1o CRYSTAL STRUCTURE OF THE HIGHLY AMYLOIDOGENIC TRANSTHYRETIN MUTANT TTR G53S/E54D/L55S 1gke RAT TRANSTHYRETIN 1gko An Engineered Transthyretin Monomer that is Non-amyloidogenic - Unless Partially Denatured 1ict MONOCLINIC FORM OF HUMAN TRANSTHYRETIN COMPLEXED WITH THYROXINE (T4) 1ie4 RAT TRANSTHYRETIN COMPLEX WITH THYROXINE (T4) 1iii CRYSTAL STRUCTURE OF THE TRANSTHYRETIN MUTANT TTR Y114C-DATA COLLECTED AT ROOM TEMPERATURE 1iik CRYSTAL STRUCTURE OF THE TRANSTHYRETIN MUTANT TTR Y114C-DATA COLLECTED AT CRYO TEMPERATURE 1ijn Crystal structure of the transthyretin mutant TTR C10A/Y114C 1kgi Rat transthyretin (also called prealbumin) complex with 3,3',5,5'-tetraiodothyroacetic acid (t4ac) 1kgj Rat transthyretin (also called prealbumin) complex with 3',5'-dibromoflavone (EMD21388) 1oo2 Crystal structure of transthyretin from Sparus aurata 1qab The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP 1qwh a covalent dimer of transthyretin that affects the amyloid pathway 1rlb RETINOL BINDING PROTEIN COMPLEXED WITH TRANSTHYRETIN 1sn0 Crystal Structure Of Sea Bream Transthyretin in complex with thyroxine At 1.9A Resolution 1sn2 Crystal Structure of Sea Bream Transthyretin at 1.90A Resolution 1sn5 Crystal Structure of Sea Bream Transthyretin in complex with Triiodothyronine at 1.90A Resolution 1sok Crystal structure of the transthyretin mutant A108Y/L110E solved in space group p21212 1soq Crystal structure of the transthyretin mutant A108Y/L110E solved in space group C2 1tfp TRANSTHYRETIN (FORMERLY KNOWN AS PREALBUMIN) 1tha MECHANISM OF MOLECULAR RECOGNITION. STRUCTURAL ASPECTS OF 3,3'-DIIODO-L-THYRONINE BINDING TO HUMAN SERUM TRANSTHYRETIN 1thc CRYSTAL STRUCTURE DETERMINATION AT 2.3A OF HUMAN TRANSTHYRETIN-3',5'-DIBROMO-2',4,4',6-TETRA-HYDROXYAURONE COMPLEX 1tlm STRUCTURAL ASPECTS OF INOTROPIC BIPYRIDINE BINDING: CRYSTAL STRUCTURE DETERMINATION TO 1.9 ANGSTROMS OF THE HUMAN SERUM TRANSTHYRETIN-MILRINONE COMPLEX 1tsh TERTIARY STRUCTURES OF THREE AMYLOIDOGENIC TRANSTHYRETIN VARIANTS AND IMPLICATIONS FOR AMYLOID FIBRIL FORMATION 1tt6 The orthorhombic crystal structure of transthyretin in complex with diethylstilbestrol 1tta THE X-RAY CRYSTAL STRUCTURE REFINEMENTS OF NORMAL HUMAN TRANSTHYRETIN AND THE AMYLOIDOGENIC VAL30MET VARIANT TO 1.7 ANGSTROMS RESOLUTION 1ttb THE X-RAY CRYSTAL STRUCTURE REFINEMENTS OF NORMAL HUMAN TRANSTHYRETIN AND THE AMYLOIDOGENIC VAL30MET VARIANT TO 1.7 ANGSTROMS RESOLUTION 1ttc THE X-RAY CRYSTAL STRUCTURE REFINEMENTS OF NORMAL HUMAN TRANSTHYRETIN AND THE AMYLOIDOGENIC VAL30MET VARIANT TO 1.7 ANGSTROMS RESOLUTION 1ttr TRANSTHYRETIN-V/122/I CARDIOMYOPATHIC MUTANT 1tyr TRANSTHYRETIN COMPLEX WITH RETINOIC ACID 1tz8 The monoclinic crystal struture of transthyretin in complex with diethylstilbestrol 1u21 transthyretin with tethered inhibitor on one monomer. 1x7s The X-ray crystallographic structure of the amyloidogenic variant TTR Tyr78Phe 1x7t Structure of TTR R104H: a non-amyloidogenic variant with protective clinical effects 1y1d Crystal structure of transthyretin in complex with iododiflunisal 1z7j Human transthyretin (also called prealbumin) complex with 3, 3',5,5'-tetraiodothyroacetic acid (t4ac) 1zcr Crystal structure of human Transthyretin with bound iodide 1zd6 Crystal structure of human transthyretin with bound chloride 2b14 The crystal structure of 2,4-dinitrophenol in complex with the amyloidogenic variant Transthyretin Leu 55 Pro 2b15 The crystal structure of 2,4-dinitrophenol in complex with human transthyretin 2b16 The crystal structure of 2,4-dinitrophenol in complex with the amyloidogenic variant Transthyretin Tyr78Phe 2b77 Human transthyretin (TTR) complexed with Diflunisal analogues- TTR.2',4'-DICHLORO-4-HYDROXY-1,1'-BIPHENYL-3-CARBOXYLIC ACID 2b9a Human transthyretin (TTR) complexed with diflunisal analogues- TTR.3',5'-difluorobiphenyl-4-carboxylic acid 2f7i Human transthyretin (TTR) complexed with diflunisal analogues- TTR. 2',6'-Difluorobiphenyl-4-carboxylic Acid 2f8i Human transthyretin (TTR) complexed with Benzoxazole 2fbr Human transthyretin (TTR) complexed with bivalant amyloid inhibitor (4 carbon linker) 2flm Human transthyretin (TTR) complexed with bivalant amyloid inhibitor (6 carbon linker) 2g2n Crystal Structure of E.coli transthyretin-related protein with bound Zn 2g2p Crystal Structure of E.coli transthyretin-related protein with bound Zn and Br 2g3x Crystal structure of Transthyretin mutant I84S at acidic pH 2g3z Crystal structure of Transthyretin mutant I84A at low pH 2g4e Crystal structure of transthyretin mutant I84A at neutral pH 2g4g Crystal structure of human transthyretin at pH 4.6 2g5u Human Transthyretin (TTR) Complexed with Hydroxylated polychlorinated Biphenyl-4,4'-dihydroxy-3,3',5,5'-tetrachlorobiphenyl 2g9k Human Transthyretin (TTR) Complexed with Hydroxylated polychlorinated Biphenyl-4-hydroxy-2',3,3',4',5-Pentachlorobiphenyl 2gab Human Transthyretin (TTR) Complexed with Hydroxylated polychlorinated Biphenyl-4-hydroxy-3,3',5,4'-tetrachlorobiphenyl 2gpz Transthyretin-like protein from Salmonella dublin 2h0e Crystal Structure of PucM in the absence of substrate 2h0f Crystal Structure of PucM in the presence of 8-azaxanthine 2h0j Crystal structure of PucM in the presence of 5,6-diaminouracil 2h1x Crystal structure of 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein) 2h4e Crystal structure of Cys10 sulfonated transthyretin 2h6u Crystal structure of 5-hydroxyisourate hydrolase (formerly known as TRP, transthyretin related protein) 2igl Crystal Structure of E. coli YEDX, a transthyretin related protein 2noy Crystal structure of transthyretin mutant I84S at PH 7.5 2pab STRUCTURE OF PREALBUMIN, SECONDARY, TERTIARY AND QUATERNARY INTERACTIONS DETERMINED BY FOURIER REFINEMENT AT 1.8 ANGSTROMS 2qel Crystal structure of the highly amyloidogenic transthyretin mutant TTR G53S/E54D/L55S- heated protein 2qgb Human transthyretin (TTR) in Apo-form 2qgc Human transthyretin (TTR) complexed with 2-(3,5-Dimethyl-4-hydroxyphenyl)benzoxazole 2qgd Human transthyretin (TTR) complexed with 2-(3,5-Dibromo-4-hydroxyphenyl)benzoxazole 2qge Human transthyretin (TTR) complexed with 2-(3,5-Dimethylphenyl)benzoxazole 2qpf Crystal Structure of Mouse Transthyretin 2rox TRANSTHYRETIN (ALSO CALLED PREALBUMIN) COMPLEX WITH THYROXINE (T4) 2roy TRANSTHYRETIN (ALSO CALLED PREALBUMIN) COMPLEX WITH 3',5'-DINITRO-N-ACETYL-L-THYRONINE 2trh TERTIARY STRUCTURES OF THREE AMYLOIDOGENIC TRANSTHYRETIN VARIANTS AND IMPLICATIONS FOR AMYLOID FIBRIL FORMATION 2try TERTIARY STRUCTURES OF THREE AMYLOIDOGENIC TRANSTHYRETIN VARIANTS AND IMPLICATIONS FOR AMYLOID FIBRIL FORMATION 2wqa Complex of TTR and RBP4 and Oleic Acid 3a4d Crystal structure of Human Transthyretin (wild-type) 3a4e Crystal structure of Human Transthyretin (E54G) 3a4f Crystal Structure of Human Transthyretin (E54K) 3b56 Crystal structure of transthyretin in complex with 3,5-diiodosalicylic acid 3bsz Crystal structure of the transthyretin-retinol binding protein-Fab complex 3bt0 Crystal structure of transthyretin variant V20S 3cbr Crystal structure of human Transthyretin (TTR) at pH3.5 3cfm Crystal structure of the apo form of human wild-type transthyretin 3cfn Crystal structure of human transthyretin in complex with 1-anilino-8-naphthalene sulfonate 3cfq Crystal structure of human wild-type transthyretin in complex with diclofenac 3cft Crystal structure of human transthyretin in complex with 1-amino-5-naphthalene sulfonate 3cn0 Human transthyretin (TTR) in complex with 3,5-Dimethyl-4-hydroxystilbene 3cn1 Human transthyretin (TTR) in complex with 3,5-Dibromo-4-hydroxystilbene 3cn2 Human transthyretin (TTR) in complex with 3,5-Dibromo-4-hydroxybiphenyl 3cn3 Human transthyretin (TTR) in complex with 1,3-Dibromo-2-hydroxy-5-phenoxybenzene 3cn4 Human transthyretin (TTR) in complex with N-(3,5-Dibromo-4-hydroxyphenyl)benzamide 3cxf Crystal structure of transthyretin variant Y114H 3d2t Human transthyretin (ttr) complexed with diflunisal 3d7p Crystal structure of human Transthyretin (TTR) at pH 4.0 3dgd Crystal structure of the F87M/L110M mutant of human transthyretin at pH 4.6 3did Crystal structure of the F87M/L110M mutant of human transthyretin at pH 4.6 soaked 3djr CRYSTAL STRUCTURE OF TRANSTHYRETIN VARIANT L58H at neutral pH 3djs Crystal structure of transthyretin variant L58H at acidic pH 3djt Crystal structure of transthyretin variant V30M at acidic pH 3djz Crystal structure of transthyretin variant L55P at neutral pH 3dk0 Crystal structure of transthyretin variant L55P at acidic pH 3dk2 Crystal structure of transthyretin variant Y114H at acidic pH 3do4 Crystal structure of transthyretin variant T60A at acidic pH 3esn Human transthyretin (TTR) complexed with N-(3,5-Dibromo-4-hydroxyphenyl)-2,6-dimethylbenzamide 3eso Human transthyretin (TTR) complexed with N-(3,5-Dibromo-4-hydroxyphenyl)-2,5-dichlorobenzamide 3esp Human transthyretin (TTR) complexed with N-(3,5-Dibromo-4-hydroxyphenyl)-3,5-dimethyl-4-hydroxybenzamide 3fc8 Crystal structure of transthyretin in complex with iododiflunisal-betaAlaOMe 3fcb Crystal structure of transthyretin in complex with iododiflunisal-betaAlaOH 3glz Human Transthyretin (TTR) complexed with(E)-3-(2-(trifluoromethyl)benzylideneaminooxy)propanoic acid (inhibitor 11) 3gps Crystal structure of the F87M/L110M mutant of human transthyretin at pH 5.5 3grb Crystal structure of the F87M/L110M mutant of human transthyretin at pH 6.5 3grg Crystal structure of the F87M/L110M mutant of human transthyretin at pH 7.5 3gs0 Human transthyretin (TTR) complexed with (S)-3-(9H-fluoren-9-ylideneaminooxy)-2-methylpropanoic acid (inhibitor 16) 3gs4 Human transthyretin (TTR) complexed with 3-(9H-fluoren-9-ylideneaminooxy)propanoic acid (inhibitor 15) 3gs7 Human transthyretin (TTR) complexed with (E)-3-(2-methoxybenzylideneaminooxy)propanoic acid (inhibitor 13) 3hj0 Transthyretin in complex with a covalent small molecule kinetic stabilizer 3i9a Crystal structure of human transthyretin variant A25T - #1 3i9i Crystal structure of human transthyretin variant A25T - #2 3i9p Crystal structure of human transthyretin - wild type 3imr Transthyretin in complex with (E)-2,6-dibromo-4-(2,6-dichlorostyryl)phenol 3ims Transthyretin in complex with 2,6-dibromo-4-(2,6-dichlorophenethyl)phenol 3imt Transthyretin in complex with (E)-4-(4-aminostyryl)-2,6-dibromophenol 3imu Transthyretin in complex with (E)-4-(3-aminostyryl)-2,6-dibromoaniline 3imv Transthyretin in complex with (E)-4-(4-aminostyryl)-2,6-dibromoaniline 3imw Transthyretin in complex with (E)-2,6-dibromo-4-(2,6-dimethoxystyryl)aniline 3ipb Human Transthyretin (TTR) complexed with a palindromic bivalent amyloid inhibitor (11 carbon linker). 3ipe Human Transthyretin (TTR) complexed with a palindromic bivalent amyloid inhibitor (7 carbon linker). 3iwu Crystal structure of Y116T/I16A double mutant of 5-hydroxyisourate hydrolase 3iwv Crystal structure of Y116T mutant of 5-HYDROXYISOURATE HYDROLASE (TRP) 3kgs V30M mutant human transthyretin (TTR) (apoV30M) pH 7.5 3kgt V30M mutant human transthyretin (TTR) complexed with genistein (V30M:GEN) pH 7.5 3kgu Wild type human transthyretin (TTR) complexed with genistein (TTRwt:GEN) pH 7.5 3m1o Human Transthyretin (TTR) complexed with 2-((3,5-dichloro-4-hydroxyphenyl)amino)benzoic acid 3nee Wild type human transthyretin (TTR) complexed with GC-1 (TTRwt:GC-1) 3neo Wild type human transthyretin (TTR) complexed with GC-24 (TTRwt:GC-24) 3nes V30M mutant human transthyretin (TTR) complexed with GC-1 (V30M:GC-1) 3nex V30M mutant human transthyretin (TTR) complexed with GC-24 (V30M:GC-24) 3ng5 Crystal Structure of V30M transthyretin complexed with (-)-epigallocatechin gallate (EGCG) 3ozk Crystal structure of human transthyretin variant A25T in complex with thyroxine (T4) 3ozl Crystal structure of human transthyretin variant A25T in complex with flufenamic acid. 3p3r Transthyretin in complex with (3,4-dihydroxy-5-nitrophenyl)(2-fluorophenyl)methanone 3p3s Human transthyretin (TTR) complexed with (Z)-5-(3,5-dibromo-4-hydroxybenzylidene)-imino-1-methylimidazolidin-4-one 3p3t Human transthyretin (TTR) complexed with 4-(3-(2-flourophenoxy)propyl)-3,5-dimethyl-1H-pyrazole 3p3u Human transthyretin (TTR) complexed with 5-(2-ethoxyphenyl)-3-(pyridin-4-yl)-1,2,4-oxadiazole 3q1e Crystal structure of Y116T/I16A double mutant of 5-hydroxyisourate hydrolase in complex with T4 3ssg Structure of transthyretin L55P in complex with Zn 3tct Structure of wild-type TTR in complex with tafamidis 3tfb Transthyretin natural mutant A25T 3u2i X-ray crystal structure of human Transthyretin at room temperature 3u2j Neutron crystal structure of human Transthyretin 3w3b Crystal structure of wild-type human transthyretin 4abq CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH LIGAND C-1 4abu CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH LIGAND C-2 4abv CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH LIGAND C-3 4abw CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH LIGAND C-6 4ac2 CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH LIGAND C-7 4ac4 CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH LIGAND C-18 4act CRYSTAL STRUCTURE OF TRANSTHYRETIN IN COMPLEX WITH LIGAND C-17 4ank Crystallographic study of novel transthyretin ligands exhibiting negative-cooperativity between two T4 binding sites. 4d7b 4D7B 4der Crystal Structure of the Wild Type TTR Binding Apigenin (TTRwt:API) 4des Crystal Structure of the Wild Type TTR Binding Chrysin (TTRwt:CHR) 4det Crystal Structure of the Wild Type TTR Binding Kaempferol (TTRwt:KAE) 4deu Crystal Structure of the Wild Type TTR Binding Naringenin (TTRwt:NAR) 4dew Crystal Structure of the Wild Type TTR Binding Luteolin (TTRwt:LUT) 4fi6 Kinetic Stabilization of transthyretin through covalent modification of K15 by 3-(5-(3,5-dichlorophenyl)-1,3,4-oxadiazol-2-yl)-benzenesulfonamide 4fi7 Kinetic Stabilization of transthyretin through covalent modification of K15 by 3-(5-(3,5-dichloro-4-hydroxyphenyl)-1,3,4-oxadiazol-2-yl)-benzenesulfonamide 4fi8 Kinetic Stabilization of transthyretin through covalent modification of K15 by 4-bromo-3-(5-(3,5-dichloro-4-hydroxyphenyl)-1,3,4-oxadiazol-2-yl)-benzenesulfonamide 4hiq The Structure of V122I Mutant Transthyretin in Complex with AG10 4his The Structure of V122I Mutant Transthyretin in Complex with Tafamidis 4hjs Kinetic stabilization of transthyretin through covalent modification of K15 by (E)-N-(4-(4-hydroxy-3,5-dimethylstyryl)ethanesulfonamide 4hjt Kinetic stabilization of transthyretin through covalent modification of K15 by (E)-N-(4-(4-hydroxy-3,5-dimethylstyryl)phenyl)propionamide 4hju Transthyretin in complex with (E)-N-(3-(4-hydroxy-3,5-dimethylstyryl)phenyl)acrylamide 4i85 Crystal structure of transthyretin in complex with CHF5074 at neutral pH 4i87 Crystal structure of TTR variant I84S in complex with CHF5074 at acidic pH 4i89 Crystal structure of transthyretin in complex with diflunisal at acidic pH 4iiz Crystal structure of wild-type human transthyretin in complex with lumiracoxib 4ik6 Crystal structure of human transthyretin in complex with lumiracoxib 4ik7 Crystal structure of human transthyretin in complex with indomethacin 4iki Crystal structure of wild-type human transthyretin in complex with indomethacin 4ikj Crystal structure of wild-type human transthyretin in complex with sulindac 4ikk Crystal structure of wild-type human transthyretin in complex with sulindac 4ikl Crystal structure of wild-type human transthyretin in complex with sulindac 4ky2 Transthyretin in complex with the fluorescent folding sensor (E)-7-hydroxy-3-(4-hydroxy-3,5-dimethylstyryl)-4-methyl-2H-chromen-2-one 4l1s Covalent modification of transthyretin K15 by yielding the fluorescent conjugate (E)-3-(dimethylamino)-5-(4-hydroxy-3,5-dimethylstyryl)benzamide 4l1t Transthyretin in complex with (E)-3-(dimethylamino)-5-(4-hydroxy-3,5-dimethylstyryl)benzoic acid 4mas High Resolution Structure of Wild Type Human Transthyretin in Complex with 3,3',5,5'-tetrachloro-[1,1'-biphenyl]-4,4'diol 4mrb Wild Type Human Transthyretin pH 7.5 4mrc Human Transthyretin Ser52Pro Mutant 4n85 Crystal structure of human transthyretin 4n86 Crystal structure of human transthyretin complexed with glabridin 4n87 Crystal structure of V30M mutant human transthyretin complexed with glabridin 4pm1 4PM1 4pme 4PME 4pmf 4PMF 4pvl 4PVL 4pvm 4PVM 4pvn 4PVN 4pwe 4PWE 4pwf 4PWF 4pwg 4PWG 4pwh 4PWH 4pwi 4PWI 4pwj 4PWJ 4pwk 4PWK 4q14 Crystal structure of 5-hydroxyisourate hydrolase from Brucella melitensis 4qrf 4QRF 4qxv 4QXV 4qya 4QYA 4tkw 4TKW 4tl4 4TL4 4tl5 4TL5 4tlk 4TLK 4tls 4TLS 4tlt 4TLT 4tlu 4TLU 4tm9 4TM9 4tne 4TNE 4tnf 4TNF 4tng 4TNG 4tq8 4TQ8 4tqh 4TQH 4tqi 4TQI 4tqp 4TQP 4wnj 4WNJ 4wns 4WNS 4wo0 4WO0 4y9b 4Y9B 4y9c 4Y9C 4y9e 4Y9E 4y9f 4Y9F 4y9g 4Y9G 4ydm 4YDM 4ydn 4YDN 5a6i 5A6I 5aks 5AKS 5akt 5AKT 5akv 5AKV 5al0 5AL0 5al8 5AL8 5ayt 5AYT 5boj 5BOJ 5clx 5CLX 5cly 5CLY 5clz 5CLZ 5cm1 5CM1 5cn3 5CN3 5cnh 5CNH 5cr1 5CR1 5dej 5DEJ 5dwp 5DWP 5e23 5E23 5e4a 5E4A 5e4o 5E4O 5en3 5EN3 5ezp 5EZP 5fo2 5FO2 5hjg 5HJG 5ihh 5IHH 5jid 5JID 5jim 5JIM 5jiq 5JIQ 5k1j 5K1J 5k1n 5K1N 5l4f 5L4F 5l4i 5L4I 5l4j 5L4J 5l4m 5L4M 5ttr LEU 55 PRO TRANSTHYRETIN CRYSTAL STRUCTURE - Links (links to other resources describing this domain)
-
INTERPRO IPR023416 PROSITE PS00769