The domain within your query sequence starts at position 1528 and ends at position 1963; the E-value for the Tet_JBP domain shown below is 7.36e-170.

SWSMYFNGCKFGRSENPRKFRLAPNYPLHNYYKRITGMSSEGSDVKTGWIIPDRKTLISR
EEKQLEKNLQELATVLAPLYKQMAPVAYQNQVEYEEVAGDCRLGNEEGRPFSGVTCCMDF
CAHSHKDIHNMHNGSTVVCTLIRADGRDTNCPEDEQLHVLPLYRLADTDEFGSVEGMKAK
IKSGAIQVNGPTRKRRLRFTEPVPRCGKRAKMKQNHNKSGSHNTKSFSSASSTSHLVKDE
STDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPA
EVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEA
DEPQHPEDDNLPQLDEFWSDSEEIYADPSFGGVAIAPIHGSVLIECARKELHATTSLRSP
KRGVPFRVSLVFYQHK

Tet_JBP

Oxygenase domain of the 2OGFeDO superfamily
Tet_JBP
SMART accession number:SM01333
Description: A double-stranded beta helix (DSBH) fold domain of the 2-oxoglutarate (2OG)-Fe(II)-dependent dioxygenase (2OGFeDO) superfamily found in various eukaryotes, bacteria and bacteriophages (PMID:19411852). Members of this family catalyze nucleic acid modifications, such as thymidine hydroxylation during base J synthesis in kinetoplastids (PMID:20215442) and the conversion of 5 methyl-cytosine (5-mC) to 5-hydroxymethyl-cytosine (hmC) (PMID:19372391) or further oxidation to 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) (PMID:21817016). Metazoan TET proteins contain a cysteine-rich region inserted into the core of the DSBH fold. Vertebrate TET proteins are oncogenes that are mutated in various myeloid cancers (PMID:21057493). Fungal and algal versions of this family are linked to a predicted transposase and show lineage-specific expansions (PMID:19411852).
Interpro abstract (IPR024779):

This entry represents the catalytic domain from nucleic-acid modifying members of the 2-oxoglutarate (2OG)-Fe(II)-dependent dioxygenase (2OGFeDO) superfamily [ (PUBMED:19411852) ]. These proteins catalyze nucleic acid modifications, such as thymidine hydroxylation during base J synthesis in kinetoplastids [ (PUBMED:20215442) ], and the conversion of 5 methyl-cytosine (5-mC) to 5-hydroxymethyl-cytosine (hmC) [ (PUBMED:19372391) ], or further oxidation to 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) [ (PUBMED:21817016) ]. Metazoan TET proteins contain a cysteine-rich region inserted into the core of the DSBH fold. Vertebrate TET proteins are oncogenes that are mutated in various myeloid cancers [ (PUBMED:21057493) ]. Fungal and algal versions of this family are linked to a predicted transposase and show lineage-specific expansions [ (PUBMED:19411852) ].

Family alignment:
View or

There are 1357 Tet_JBP domains in 1357 proteins in SMART's nrdb database.

Click on the following links for more information.