The domain within your query sequence starts at position 890 and ends at position 1012; the E-value for the UBA_e1_C domain shown below is 1.04e-49.
YKNCFLNLAIPIIVFTETSEVRKTEIRNGISFTIWDRWTVHGKEDFTLSDFINAVKENYG IEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKKYVDLTVSFAPDADGDEDLPG PPV
UBA_e1_CUbiquitin-activating enzyme e1 C-terminal domain |
---|
SMART accession number: | SM00985 |
---|---|
Description: | This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised. |
Interpro abstract (IPR018965): | This domain is found at the C terminus of Ubiquitin-activating enzyme E1 proteins. It binds to E2 enzymes [ (PUBMED:18662542) ]. |
Family alignment: |
There are 2712 UBA_e1_C domains in 2709 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)