The domain within your query sequence starts at position 2 and ends at position 117; the E-value for the UBCc domain shown below is 5.4e-4.

All catalytic sites are present in this domain. Check the literature (PubMed 97407928 ) for details.

TPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVST
ILTGLLSFMVEKGPTLGSIETSDFTKKQLAAQSLVFNLKDKVFCELFPEVVEEIKQ

UBCc

Ubiquitin-conjugating enzyme E2, catalytic domain homologues
UBCc
SMART accession number:SM00212
Description: Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. This pathway functions in regulating many fundamental processes required for cell viability.TSG101 is one of several UBC homologues that lacks this active site cysteine.
Family alignment:
View or

There are 43578 UBCc domains in 43296 proteins in SMART's nrdb database.

Click on the following links for more information.