The domain within your query sequence starts at position 1 and ends at position 111; the E-value for the VKc domain shown below is 8.84e-23.

XDVGTAISCSRVFSSRWGRGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWA
SILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYAINVGLMLLSFQKV

VKc

VKc
SMART accession number:SM00756
Description: Family of likely enzymes that includes the catalytic subunit of vitamin K epoxide reductase. Bacterial homologues are fused to members of the thioredoxin family of oxidoreductases.
Interpro abstract (IPR012932):

Vitamin K epoxide reductase (VKOR) recycles vitamin K 2,3-epoxide to vitamin K hydroquinone, a co-factor that is essential for the posttranslational gamma-carboxylation of several blood coagulation factors [ (PUBMED:14765194) ]. VKORC1, the catalytic subunit of the VKOR complex, is a member of a large family of predicted enzymes that are present in vertebrates, Drosophila, plants, bacteria and archaea [ (PUBMED:15276181) ]. Bacterial VKOR homologues catalyse disulphide bridge formation in secreted proteins by cooperating with a periplasmic, Trx-like redox partner [ (PUBMED:18413314) (PUBMED:18695247) ]. In fact, in some plant and bacterial homologues the VKORC1 homologous domain is fused with domains of the thioredoxin family of oxidoreductases [ (PUBMED:15276181) ]. VKOR is part of a disulphide bond formation pathway that uses electrons from cysteines of newly synthesized proteins to reduce a quinone [ (PUBMED:20110994) ].

Family alignment:
View or

There are 5031 VKc domains in 5031 proteins in SMART's nrdb database.

Click on the following links for more information.