The domain within your query sequence starts at position 196 and ends at position 797; the E-value for the VPS10 domain shown below is < 1e-12.

DYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSL
LISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQESVVP
NRFYWSVMGSSKEPDLVHLEARTVDGHSIYLTCRMQNCTEANRNKPFPGYIDPDSLIVQD
DYVFVQLTSGGRPHYYVSYRRSPFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDT
YNLYISDTRGVYFTLALENVQSSRGPEGNVMIDLYEVAGIKGMFLANKKIDNQVKTFITY
NKGRDWRLLQAPDADLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASRDTAPSIIVASG
NIGSELSDSDISMFVSSDAGNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFD
EGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAE
EDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYE
RHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCTDGVREQYTAKPQKCPGK
AP

VPS10

• SMART accession number: SM00602
• Description: -
• Interpro abstract (IPR006581):

  Yeast Vps10p is a receptor for sorting and transport of the soluble vacuolar hydrolase carboxypeptidase Y to the lysosome-like vacuole [ (PUBMED:11801606) ]. In mammalian cells, proteins containing this domain are involved in the transport of lipoproteins and sorting of endosomal proteins. They may also act as receptors for some neuropeptides.

  The N terminus of murine brain SorCS contains two putative cleavage sites for the convertase furin which mark the beginning of the VPS10 domain, which is followed by a module of imperfect leucine-rich repeats and a transmembrane domain. The short intracellular C terminus contains consensus signals for rapid internalization. The identified putative binding motifs for SH2 and SH3 domains are unique in the family of VPS10 domain receptors. SorCS is predominantly expressed in brain, but also in heart, liver, and kidney. SorCS transcripts detected by in situ hybridization in the murine central nervous system point to a neuronal expression [ (PUBMED:10600506) (PUBMED:10329739) ].

• GO component: integral component of membrane (GO:0016021)

There are 3763 VPS10 domains in 3066 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Hama H, Tall GG, Horazdovsky BF
• Vps9p is a guanine nucleotide exchange factor involved in vesicle-mediated vacuolar protein transport.
• J Biol Chem. 1999; 274: 15284-91

Vacuolar protein sorting (vps) mutants of Saccharomyces cerevisiae missort and secrete vacuolar hydrolases. The gene affected in one of these mutants, VPS21, encodes a member of the Sec4/Ypt/Rab family of small GTPases. Rab proteins play an essential role in vesicle-mediated protein transport. Using both yeast two-hybrid assays and chemical cross-linking, we have identified another VPS gene product, Vps9p, that preferentially interacts with a mutant form of Vps21p-S21N that binds GDP but not GTP. In vitro purified Vps9p was found to stimulate GDP release from Vps21p in a dose-dependent manner. Vps9p also stimulated GTP association as a result of facilitated GDP release. However, Vps9p did not stimulate guanine nucleotide exchange of GTP-bound Vps21p or GTP hydrolysis. We tested the ability of Vps9p to stimulate the intrinsic guanine nucleotide exchange activity of Rab5, which is a mammalian sequence homologue of Vps21p, and Ypt7p, which is another yeast Rab protein involved in vacuolar protein transport. Rab5, but not Ypt7p was responsive to Vps9p, which indicates that Vps9p recognizes sequence variation among Rab proteins. We conclude that Vps9p is a novel guanine nucleotide exchange factor that is specific for Vps21p/Rab5. Since there are no obvious Vps9p sequence homologues in yeast, Vps9p may also possess unique regulatory functions required for vacuolar protein transport.

Structure (3D structures containing this domain)

3D Structures of VPS10 domains in PDB

PDB code	Title
3f6k	Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with neurotensin
3wsx	3WSX
3wsy	3WSY
3wsz	3WSZ
4msl	Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with AF40431
4n7e	Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with AF38469
4po7	4PO7

Links (links to other resources describing this domain)

• INTERPRO: IPR006581