The domain within your query sequence starts at position 196 and ends at position 797; the E-value for the VPS10 domain shown below is < 1e-12.

DYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSL
LISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQESVVP
NRFYWSVMGSSKEPDLVHLEARTVDGHSIYLTCRMQNCTEANRNKPFPGYIDPDSLIVQD
DYVFVQLTSGGRPHYYVSYRRSPFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDT
YNLYISDTRGVYFTLALENVQSSRGPEGNVMIDLYEVAGIKGMFLANKKIDNQVKTFITY
NKGRDWRLLQAPDADLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASRDTAPSIIVASG
NIGSELSDSDISMFVSSDAGNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFD
EGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAE
EDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYE
RHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCTDGVREQYTAKPQKCPGK
AP

VPS10

VPS10
SMART accession number:SM00602
Description: -
Interpro abstract (IPR006581):

Yeast Vps10p is a receptor for sorting and transport of the soluble vacuolar hydrolase carboxypeptidase Y to the lysosome-like vacuole [(PUBMED:11801606)]. In mammalian cells, proteins containing this domain are involved in the transport of lipoproteins and sorting of endosomal proteins. They may also act as receptors for some neuropeptides.

The N terminus of murine brain SorCS contains two putative cleavage sites for the convertase furin which mark the beginning of the VPS10 domain, which is followed by a module of imperfect leucine-rich repeats and a transmembrane domain. The short intracellular C terminus contains consensus signals for rapid internalization. The identified putative binding motifs for SH2 and SH3 domains are unique in the family of VPS10 domain receptors. SorCS is predominantly expressed in brain, but also in heart, liver, and kidney. SorCS transcripts detected by in situ hybridization in the murine central nervous system point to a neuronal expression [(PUBMED:10600506), (PUBMED:10329739)].

GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 3763 VPS10 domains in 3066 proteins in SMART's nrdb database.

Click on the following links for more information.