The domain within your query sequence starts at position 327 and ends at position 366; the E-value for the WD40 domain shown below is 7.05e-9.

PTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWE

WD40

WD40 repeats
WD40
SMART accession number:SM00320
Description: Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.
Interpro abstract (IPR001680):

WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein or protein-DNA interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins [ (PUBMED:30069656) ]. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [ (PUBMED:11814058) (PUBMED:10322433) ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 1918936 WD40 domains in 345139 proteins in SMART's nrdb database.

Click on the following links for more information.