The domain within your query sequence starts at position 34 and ends at position 73; the E-value for the WD40 domain shown below is 4.11e-10.

NYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWG

WD40

WD40 repeats
WD40
SMART accession number:SM00320
Description: Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.
Interpro abstract (IPR001680):

WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [(PUBMED:11814058), (PUBMED:10322433)]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 570418 WD40 domains in 98768 proteins in SMART's nrdb database.

Click on the following links for more information.