The domain within your query sequence starts at position 553 and ends at position 633; the E-value for the WGR domain shown below is 2.36e-31.

FSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNKLEQMPSKEDAVE
HFMKLYEEKTGNAWHSKNFTK

WGR

Proposed nucleic acid binding domain
WGR
SMART accession number:SM00773
Description: This domain is named after its most conserved central motif. It is found in a variety of polyA polymerases as well as in molybdate metabolism regulators (e.g. in E.coli) and other proteins of unknown function. The domain is found in isolation in some proteins and is between 70 and 80 residues in length. It is proposed that it may be a nucleic acid binding domain.
Interpro abstract (IPR008893):

This domain is named after the most conserved central motif of the domain. It is found in a variety of polyA polymerases as well as the Escherichia coli molybdate metabolism regulator P33345 and other proteins of unknown function.The domain is found in isolation in proteins such as Q9JN21 and is between 70 and 80 residues in length.

Family alignment:
View or

There are 6953 WGR domains in 6872 proteins in SMART's nrdb database.

Click on the following links for more information.