The domain within your query sequence starts at position 16 and ends at position 72; the E-value for the WHEP-TRS domain shown below is 3.01e-23.

LFNSIATQGELVRSLKAGNAPKDEIDSAVKMLLSLKMSYKAAMGEEYKAGCPPGNPT

WHEP-TRS

WHEP-TRS
SMART accession number:SM00991
Description: A conserved domain of 46 amino acids, called WHEP-TRS has been shown (PUBMED:1756734) to exist in a number of higher eukaryote aminoacyl-transfer RNA synthetases. This domain is present one to six times in the several enzymes. There are three copies in mammalian multifunctional aminoacyl-tRNA synthetase in a region that separates the N-terminal glutamyl-tRNA synthetase domain from the C-terminal prolyl-tRNA synthetase domain, and six copies in the intercatalytic region of the Drosophila enzyme. The domain is found at the N-terminal extremity of the mammalian tryptophanyl- tRNA synthetase and histidyl-tRNA synthetase, and the mammalian, insect, nematode and plant glycyl- tRNA synthetases (PUBMED:8463296). This domain could contain a central alpha-helical region and may play a role in the association of tRNA-synthetases into multienzyme complexes.
Interpro abstract (IPR000738):

A conserved domain of 46 amino acids, called WHEP-TRS has been shown [ (PUBMED:1756734) ] to exist in a number of higher eukaryote aminoacyl-transfer RNA synthetases. This domain is present one to six times in the several enzymes. There are three copies in mammalian multifunctional aminoacyl-tRNA synthetase in a region that separates the N-terminal glutamyl-tRNA synthetase domain from the C-terminal prolyl-tRNA synthetase domain, and six copies in the intercatalytic region of the Drosophila enzyme. The domain is found at the N-terminal extremity of the mammalian tryptophanyl-tRNA synthetase and histidyl-tRNA synthetase, and the mammalian, insect, nematode and plant glycyl-tRNA synthetases [ (PUBMED:8463296) ]. The structure of a human WHEP-TRS domain has been solved and consists of two helices arranged in a helix-turn-helix [ (PUBMED:11123902) ]. The WHEP-TRS domain may play a role in the association of tRNA-synthetases into multienzyme complexes [ (PUBMED:9556618) ].

GO process:tRNA aminoacylation for protein translation (GO:0006418)
GO function:aminoacyl-tRNA ligase activity (GO:0004812), ATP binding (GO:0005524)
Family alignment:
View or

There are 6225 WHEP-TRS domains in 3507 proteins in SMART's nrdb database.

Click on the following links for more information.