The domain within your query sequence starts at position 776 and ends at position 845; the E-value for the XPGI domain shown below is 1.02e-33.

RLFGVPYIQAPMEAEAQCAMLDLTDQTSGTITDDSDIWLFGARHVYKNFFNKNKFVEYYQ
YVDFYSQLGL

XPGI

Xeroderma pigmentosum G I-region
XPGI
SMART accession number:SM00484
Description: domain in nucleases
Interpro abstract (IPR006086):

This entry represents a domain found on Xeroderma Pigmentosum Complementation Group G (XPG) protein [ (PUBMED:8206890) ]. XPG is a DNA endonuclease involved in DNA excision repair [ (PUBMED:8078765) ]. The internal XPG (XPG-I) domain contains many cysteine and glutamate amino acid residues that are frequently found in various enzyme active sites of DNA nucleases. The I domain, together with the N-terminal, forms the catalytic domain that contains the active site [ (PUBMED:14726017) ].

GO function:nuclease activity (GO:0004518)
Family alignment:
View or

There are 7650 XPGI domains in 7639 proteins in SMART's nrdb database.

Click on the following links for more information.