The domain within your query sequence starts at position 500 and ends at position 597; the E-value for the YccV-like domain shown below is 8.22e-39.

DVCYSIGLVMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGS
CRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPN

YccV-like

Hemimethylated DNA-binding protein YccV like
YccV-like
SMART accession number:SM00992
Description: YccV is a hemimethylated DNA binding protein which has been shown to regulate dnaA gene expression. The structure of one of the hypothetical proteins in this family has been solved and it forms a beta sheet structure with a terminating alpha helix.
Interpro abstract (IPR011722):

Heat shock protein HspQ, also known as YccV, is an Escherichia coli hemimethylated DNA binding protein which has been shown to regulate dnaA gene expression [ (PUBMED:12700277) ].

This entry represents a YccV-like hemimethylated DNA binding domain that can also be found in longer eukaryotic proteins.

GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 4240 YccV-like domains in 4235 proteins in SMART's nrdb database.

Click on the following links for more information.