The domain within your query sequence starts at position 500 and ends at position 597; the E-value for the YccV-like domain shown below is 8.22e-39.
LVMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQE NLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRY
YccV-likeHemimethylated DNA-binding protein YccV like |
---|
SMART accession number: | SM00992 |
---|---|
Description: | YccV is a hemimethylated DNA binding protein which has been shown to regulate dnaA gene expression. The structure of one of the hypothetical proteins in this family has been solved and it forms a beta sheet structure with a terminating alpha helix. |
Interpro abstract (IPR011722): | Heat shock protein HspQ, also known as YccV, is an Escherichia coli hemimethylated DNA binding protein which has been shown to regulate dnaA gene expression [ (PUBMED:12700277) ]. This entry represents a YccV-like hemimethylated DNA binding domain that can also be found in longer eukaryotic proteins. |
GO function: | DNA binding (GO:0003677) |
Family alignment: |
There are 4240 YccV-like domains in 4235 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)