The domain within your query sequence starts at position 284 and ends at position 337; the E-value for the ZnF_BED domain shown below is 3.68e-16.
RRRSAVWKHFYLSPLDSSKAVCVHCMNEFSRGKNGKDLGTSCLIRHMWRAHRSI
ZnF_BEDBED zinc finger |
---|
SMART accession number: | SM00614 |
---|---|
Description: | DNA-binding domain in chromatin-boundary-element-binding proteins and transposases |
Interpro abstract (IPR003656): | The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [ (PUBMED:10973053) ]. Some proteins known to contain a BED domain are listed below:
|
GO function: | DNA binding (GO:0003677) |
Family alignment: |
There are 7169 ZnF_BED domains in 4785 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)