The domain within your query sequence starts at position 54 and ends at position 88; the E-value for the ZnF_CDGSH domain shown below is 3.39e-9.

KTPIRLELVAGKTYRWCVCGRSKNQPFCDGSHFFQ

ZnF_CDGSH

CDGSH-type zinc finger. Function unknown.
ZnF_CDGSH
SMART accession number:SM00704
Description: -
Interpro abstract (IPR018967):

This entry represents iron-sulphur domain containing proteins that have a CDGSH sequence motif (although the Ser residue can also be an Ala or Thr), and is found in proteins from a wide range of organisms with the exception of fungi. The CDGSH-type domain binds a redox-active pH-labile 2Fe-2S cluster. The conserved sequence C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H is a defining feature of this family [ (PUBMED:17376863) ].

CDGSH-type domains are found in mitoNEET, an iron-containing integral protein of the outer mitochondrian membrane (OMM). MitoNEET forms a dimeric structure with a NEET fold, and contains two domains: a beta-cap region and a cluster-binding domain that coordinated two acid-labile 2Fe-2S clusters (one bound to each protomer) [ (PUBMED:17766440) ]. The CDGSH iron-sulphur domain is oriented towards the cytoplasm and is tethered to the mitochondrial membrane by a more N-terminal domain found in higher vertebrates, ( IPR019610 ) [ (PUBMED:17584744) (PUBMED:17766440) ]. The whole protein regulates oxidative capacity and may function in electron transfer, for instance in redox reactions with metabolic intermediates, cofactors and/or proteins localized at the OMM.

GO component:intracellular membrane-bounded organelle (GO:0043231)
GO function:2 iron, 2 sulfur cluster binding (GO:0051537)
Family alignment:
View or

There are 5690 ZnF_CDGSH domains in 3268 proteins in SMART's nrdb database.

Click on the following links for more information.