The domain within your query sequence starts at position 1 and ends at position 108; the E-value for the btg1 domain shown below is 1.28e-81.

MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTQILQEKYKNHWYPEKPSKGQAYRCI
RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEK

btg1

tob/btg1 family
btg1
SMART accession number:SM00099
Description: The tob/btg1 is a family of proteins that inhibit cell proliferation.
Interpro abstract (IPR002087):

This entry represents a conserved domain found in the N-terminal of the BTG family members (also known as anti-proliferative proteins). In mammals, BTG family comprises six proteins: BTG1, BTG2/PC3/Tis21, BTG3/ANA, BTG4/PC3B, Tob1/Tob and Tob2. They regulate cell cycle progression in a variety of cell types [ (PUBMED:19746446) ].

These proteins have from 158 to 363 amino acid residues, that are highly similar and include 3 conserved cysteine residues. BTG2 seems to have a signal sequence; while the other proteins may lack such a domain.

Family alignment:
View or

There are 1150 btg1 domains in 1147 proteins in SMART's nrdb database.

Click on the following links for more information.