The domain within your query sequence starts at position 438 and ends at position 468; the E-value for the c-clamp domain shown below is 2.08e-14.
PKKCRARFGLDQQNNWCGPCRRKKKCVRYIQ
c-clamp |
---|
SMART accession number: | SM01366 |
---|---|
Description: | Sequence-specific DNA binding domain in TCFs. |
Family alignment: |
There are 2843 c-clamp domains in 2828 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)