The domain within your query sequence starts at position 43 and ends at position 234; the E-value for the rADc domain shown below is 5.56e-69.

LTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQMLSDAAP
GKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKD
GPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPK
VDVGVVHLTPLI

rADc

Ribosomal RNA adenine dimethylases
rADc
SMART accession number:SM00650
Description: -
Interpro abstract (IPR020598):

The bacterial enzyme KsgA catalyses the transfer of a total of four methyl groups from S-adenosyl-l-methionine (S-AdoMet) to two adjacent adenosine bases in 16S rRNA. This enzyme and the resulting modified adenosine bases appear to be conserved in all species of eubacteria, eukaryotes, and archaea, and in eukaryotic organelles. Bacterial resistance to the aminoglycoside antibiotic kasugamycin involves inactivation of KsgA and resulting loss of the dimethylations, with modest consequences to the overall fitness of the organism. In contrast, the yeast ortholog, Dim1, is essential. In Saccharomyces cerevisiae (Baker's yeast), and presumably in other eukaryotes, the enzyme performs a vital role in pre-rRNA processing in addition to its methylating activity [ (PUBMED:15136037) ]. Another orthologue is the eukaryotic transcription factor B (TFB), which has a second function; this enzyme is a nuclear-encoded mitochondrial transcription factor and is essential for mitochondrial gene expression [ (PUBMED:23804760) ]. The best conserved region in these enzymes is located in the N-terminal section and corresponds to a region that is probably involved in S-adenosyl methionine (SAM) binding domain.

This entry represents the N-terminal domain of rRNA adenine methylase transferases.

GO process:rRNA modification (GO:0000154)
GO function:rRNA methyltransferase activity (GO:0008649), rRNA (adenine-N6,N6-)-dimethyltransferase activity (GO:0000179)
Family alignment:
View or

There are 25299 rADc domains in 25297 proteins in SMART's nrdb database.

Click on the following links for more information.